DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33626

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster


Alignment Length:118 Identity:28/118 - (23%)
Similarity:57/118 - (48%) Gaps:8/118 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CRLKVLGRGIIGANIHVKLL-KLPINRMVVRFITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVF 102
            |::....|.::  |:.:||| :|...::.::..|..|....:...|:::.:.|||:....:..:.
  Fly    37 CQIGGTRRSLL--NVELKLLTELDQIKVYIKISTRFKSTTLYRKFFDITFDGCRVISDMVQGTMV 99

  Fly   103 YYFYTAFMPFSNINHTCPYN-DDIYIRNCTLDDRMFAKVPLPKGSYKLTLEMD 154
            ...:.|.:..||....||.| ..||..|.:::|.:...||    |.:|.:::|
  Fly   100 SNMFNAVVKSSNQPRKCPVNKGTIYYHNISIEDALPMFVP----SAQLFIQID 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 19/79 (24%)
CG33626NP_001027405.2 DUF1091 62..140 CDD:284008 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.