DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33647

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:144 Identity:27/144 - (18%)
Similarity:46/144 - (31%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFI---TYRKLNGYHP 80
            |.:|.::|.:|....|....|.|.....              |...:...||   ....|.|.:.
  Fly    28 VFMTKIECLNYMPELVRNVSCYLNETSH--------------PTGSIYAEFILTQDVEDLKGIYI 78

  Fly    81 FLF-------NVSEEH---CRVLRYPNRLRVFYYFYTAFMPFSNINHTCP--YNDDIYIRNCTLD 133
            ..|       |.:..|   |::|.......:|....|.....:|....||  .|...|.:..|::
  Fly    79 LTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPLKMNKRYYAKGFTVN 143

  Fly   134 DRMFAKVPLPKGSY 147
            .: |....:|:.::
  Fly   144 SK-FIPSYMPETNF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 18/93 (19%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 12/61 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.