DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33703

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:146 Identity:39/146 - (26%)
Similarity:67/146 - (45%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLFIGESHGYV-RLTNLKCESYDKSFVVFPECRL--KVLGRGIIGANIHVKLLKLPINRMVVRFI 70
            |:.:..|.|.| |::.::|.|.|.||..|..|::  :..||..:..: .|.|.|.||:.:|:...
  Fly    13 LIILDCSQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKDPIDDIVLNLG 76

  Fly    71 TYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTLDDR 135
            .:|..........|.:.::|...|.......|.:..|..:..||:|.|||...:|.....::|:.
  Fly    77 VFRIAKNRRFQFLNETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITFNGFSVDEN 141

  Fly   136 MFAKVPLPKGSYKLTL 151
            ...::|:|.|.|...|
  Fly   142 TIKEIPIPNGVYMFHL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 18/78 (23%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.