DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33703

DIOPT Version :10

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:146 Identity:39/146 - (26%)
Similarity:67/146 - (45%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLFIGESHGYV-RLTNLKCESYDKSFVVFPECRL--KVLGRGIIGANIHVKLLKLPINRMVVRFI 70
            |:.:..|.|.| |::.::|.|.|.||..|..|::  :..||..:..: .|.|.|.||:.:|:...
  Fly    13 LIILDCSQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKDPIDDIVLNLG 76

  Fly    71 TYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTLDDR 135
            .:|..........|.:.::|...|.......|.:..|..:..||:|.|||...:|.....::|:.
  Fly    77 VFRIAKNRRFQFLNETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITFNGFSVDEN 141

  Fly   136 MFAKVPLPKGSYKLTL 151
            ...::|:|.|.|...|
  Fly   142 TIKEIPIPNGVYMFHL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 18/78 (23%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:461928 18/81 (22%)

Return to query results.
Submit another query.