DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33642

DIOPT Version :10

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:175 Identity:38/175 - (21%)
Similarity:73/175 - (41%) Gaps:46/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLLWISLLFIGESHGYVRLTN---LKCESYDKSF-VVFPECRLKVLGRGIIGANIHVKLLKLPIN 63
            :|||              .||   ||||  ::|| :...|..:|...|.:| .:|..:::.|. |
  Fly    11 WLLW--------------FTNHICLKCE--ERSFRIKMNEFAVKYKMRDLI-QHIDFRIVNLN-N 57

  Fly    64 R------MVVR-----------FITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMP 111
            |      |:|:           ...::..|.....|::...:.|:.|:..:|..:|..:..:|..
  Fly    58 RSYVNGEMIVKSDVEDILMHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKK 122

  Fly   112 FSNINHTCPY--NDDIYIRNCTLDDRMFAKVP--LPKGSYKLTLE 152
            ..:.|.:||.  |.:..:.|..:|::   .:|  :|.|:::...|
  Fly   123 HIHGNLSCPLRTNFNYTLTNWHMDEK---DLPPFVPLGTFRTVTE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 16/82 (20%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 16/83 (19%)

Return to query results.
Submit another query.