DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33137

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:70/169 - (41%) Gaps:30/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFITYRK-- 74
            :.|.:...:|.|::|.:. ..|.....|.::.:......|.:.|.||: |:..:.:||...:|  
  Fly     7 LSEPNIVYKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDY 69

  Fly    75 LNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMP-----------FSNINHTCPYNDDIYIR 128
            .|.:.|||.:|....|..|.           ..:|:|           |||.||:|||...:..|
  Fly    70 SNKFQPFLVDVVINMCDALS-----------RRSFIPYGLIILKIARTFSNFNHSCPYRGHLMAR 123

  Fly   129 NCTLDDRMFAKVPLPKGSYKLTLEMDDGVVNWISIINIH 167
            ...|::.....| .|.|.||..:.:   :.|:|:..:.|
  Fly   124 GAYLNESYLPNV-FPLGFYKFNITI---MENYITPPSAH 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 24/91 (26%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.