DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG13193

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:139 Identity:31/139 - (22%)
Similarity:57/139 - (41%) Gaps:21/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RLTNLKCE---SYDKSFVVFPECRLKVLGRGIIGANIHV-KLLKLPINRMVVRFITYRKLNGYHP 80
            :.||:..|   .|..|.      |..:..:|.:..:||: :.||   |.:.......:.::|...
  Fly    36 KFTNISVECSKDYCSSI------RGWLTAKGELNLDIHLNRTLK---NGLRTTITLLQLIDGKDR 91

  Fly    81 F--LFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIY-IRNCTLDDRMFAKVP- 141
            :  ||:...:.|:.||...:..:...:......:.|:...||.....| :||..|::.   .:| 
  Fly    92 YQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENH---SIPG 153

  Fly   142 -LPKGSYKL 149
             ||.|.|:|
  Fly   154 YLPAGFYRL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 18/83 (22%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.