powered by:
Protein Alignment CG33679 and CG30050
DIOPT Version :9
Sequence 1: | NP_001027273.1 |
Gene: | CG33679 / 3772494 |
FlyBaseID: | FBgn0053679 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_725159.2 |
Gene: | CG30050 / 246417 |
FlyBaseID: | FBgn0050050 |
Length: | 192 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 15/70 - (21%) |
Similarity: | 26/70 - (37%) |
Gaps: | 26/70 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTLDDRMFAKV---PLP 143
:|:::.:.|:|||...|..:. |:.:. ||.....||. |.|
Fly 91 IFDITFDVCKVLRERKRKILI---------------------DLLVN--TLAKNSNAKAWRCPFP 132
Fly 144 KGSYK 148
||.::
Fly 133 KGKFE 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33679 | NP_001027273.1 |
DUF1091 |
70..149 |
CDD:284008 |
15/70 (21%) |
CG30050 | NP_725159.2 |
DM8 |
90..177 |
CDD:214778 |
15/70 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.