powered by:
Protein Alignment CG33679 and K12H4.7
DIOPT Version :9
Sequence 1: | NP_001027273.1 |
Gene: | CG33679 / 3772494 |
FlyBaseID: | FBgn0053679 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498758.2 |
Gene: | K12H4.7 / 176136 |
WormBaseID: | WBGene00019682 |
Length: | 510 |
Species: | Caenorhabditis elegans |
Alignment Length: | 33 |
Identity: | 8/33 - (24%) |
Similarity: | 17/33 - (51%) |
Gaps: | 2/33 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 PKGSYKLTLEMD--DGVVNWISIINIHFEIDVD 173
|:|..|.|..|. ..::|:.::::..|...:|
Worm 36 PRGGMKKTPPMSSVSHMINFDNVVSSTFTQTLD 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.