DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33812 and H3Y1

DIOPT Version :10

Sequence 1:NP_001027298.1 Gene:His3:CG33812 / 3772489 FlyBaseID:FBgn0053812 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001342187.1 Gene:H3Y1 / 391769 HGNCID:43735 Length:136 Species:Homo sapiens


Alignment Length:134 Identity:107/134 - (79%)
Similarity:121/134 - (90%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            ||||||||||:|..:||||.||||||.|.||.|||:||||||:|||:||||||:|||||:||:||
Human     1 MARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||....||||||:|:.|||||||||||.||||||||||||:||||||:|:|||||
Human    66 LPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARR 130

  Fly   131 IRGE 134
            :|.|
Human   131 LRRE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33812NP_001027298.1 PTZ00018 1..136 CDD:185400 107/134 (80%)
H3Y1NP_001342187.1 HFD_SF 1..134 CDD:480273 106/132 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 32/41 (78%)

Return to query results.
Submit another query.