DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33812 and H3c4

DIOPT Version :10

Sequence 1:NP_001027298.1 Gene:His3:CG33812 / 3772489 FlyBaseID:FBgn0053812 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_835511.1 Gene:H3c4 / 319149 MGIID:2448322 Length:136 Species:Mus musculus


Alignment Length:41 Identity:10/41 - (24%)
Similarity:17/41 - (41%) Gaps:5/41 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VFNSKGCTVFDSKGNLIYRVDNYDSKSWSNEVYFMDLNGKI 92
            :|||     |..||.::..|..|.|:.....::.....|.:
Mouse   254 LFNS-----FKPKGGVVLSVTVYPSEFGKERIHAEQTQGPL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33812NP_001027298.1 PTZ00018 1..136 CDD:185400 10/41 (24%)
H3c4NP_835511.1 PTZ00018 1..136 CDD:185400
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.