DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG13250

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:147 Identity:23/147 - (15%)
Similarity:55/147 - (37%) Gaps:26/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCLLFLTEL-------HGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPM 68
            |:||.|.:..|       ....:|:.::.|...|.:.:.:..|.:..:.|.:.:....:.:|:..
  Fly    11 LILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRS 75

  Fly    69 FTNIEIYF---QLMTRGSESIHAASNWQPFLHTMKLDLCRF--WKNHHNHLARMVFEFIDGHTNM 128
            .|.:.:..   |:..|....:..       |..:::|.|..  :::....|..::.:.:.. .|.
  Fly    76 VTKMWVELSVGQIANRKDRPVQQ-------LFKIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNY 132

  Fly   129 NHTCP------YTKEKY 139
            ...||      ||..::
  Fly   133 PDACPLLANVNYTSTRF 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 9/63 (14%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 9/63 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.