DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33644

DIOPT Version :10

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:125 Identity:23/125 - (18%)
Similarity:46/125 - (36%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DLSMSIVE------------YCAVTTLSKN--KNSISLRYAMLKPMFTNIEIYFQLMTRGSESIH 87
            |.||:.:|            .|.:...|.|  ..|.|..:::.|.:......|.....:|...|:
  Fly     2 DASMTQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRKEVNDVRGAYVFSFKQGKSIIN 66

  Fly    88 AASNWQPFLHTMKLDLCRFWKNHHNH-LARMVFEFIDGHTNMNHTCPYTKEKYISIDDLT 146
            ..:        |::|.|:......:. |.:::.:.:...:|....||:...|...:|:.|
  Fly    67 YTA--------MEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 10/60 (17%)
CG33644NP_001027259.1 DUF1091 64..133 CDD:461928 11/63 (17%)

Return to query results.
Submit another query.