DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33767

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:137 Identity:26/137 - (18%)
Similarity:47/137 - (34%) Gaps:34/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SKDLSMSIVEYC-----------AVT----------------TLSKNKNSISLRYAMLKPMFTNI 72
            |.|:|:.:::.|           |:|                ||....|::.:.....||:...:
  Fly    10 SLDISIEMLKVCTLVSIIFVHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGL 74

  Fly    73 EIYFQLMTRGSESIHAASNWQP-FLHTMKLDLCRFWKNHHNHLARMVFEFIDGHTNMNHTCPYTK 136
            ::......    |:....::|. |.|.  ||.|....:...:|.:..|:.:..|.|....||...
  Fly    75 KVLLNTQI----SLDKGRSYQRLFAHI--LDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPA 133

  Fly   137 EKYISID 143
            ..|...|
  Fly   134 GHYFLRD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 15/60 (25%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.