DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33783

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:176 Identity:46/176 - (26%)
Similarity:78/176 - (44%) Gaps:26/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTR 81
            |.|...||    .|:.|...:.|...::.|.:..|.:.          :..:|.:.:.: ||...
  Fly     3 FKTNPIGV----VNIKCTCYEKSFCELKRCELKVLGRG----------IVGLFLHAQAH-QLPIN 52

  Fly    82 GSESI----HAASNWQPFLHTMKLDLCRFWKNHHNH-LARMVFEFIDGHTNMNHTCPYTKEKYIS 141
            .|..|    ...:.::|||:.|.:|:|.|:||...: ...:|::.|...:|:||:||:..:  |.
  Fly    53 SSTCILSLYRRFNGYRPFLYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHD--II 115

  Fly   142 IDDLT-NTEVSAKIRGVPMPKGFYALFTTWSTENITRVVTNFYFEV 186
            ::.:. |..:..|   ||.|.|||.|.....|:.|.|.....|.||
  Fly   116 VNRMVLNDNMIVK---VPFPSGFYKLMFILKTDGIWRGEVEVYVEV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 26/86 (30%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472277
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.