DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33702

DIOPT Version :10

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster


Alignment Length:178 Identity:45/178 - (25%)
Similarity:79/178 - (44%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLGLLLCLLFLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNI 72
            :..:.|.::..:...|...||||..|.|.|...::|:.|.:..:.::...|:...|:......| 
  Fly     6 ITNVFLTIILFSSTLGAHFRFTNFKCISLDPEFAVVKECILKMVRRSVVGINFHIAIKYSQPIN- 69

  Fly    73 EIYFQLMTRGSESIHAASN-WQPFLHTMKLDLCRFWKNHHNH-LARMVFEFIDGHTNMNHTCPYT 135
            :|.|.|      ||...|| ::.||....:|.|.:.:....: :..|..:.:...||.||:||||
  Fly    70 KIEFNL------SIFRKSNMYRLFLVNHTIDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPYT 128

  Fly   136 KEKYISIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENITRVVTNFY 183
             ||.|.:..:|..:.:.|.....:|.|.|.|..:.....:.|:..|.:
  Fly   129 -EKDIYVKKMTFNDKTLKDLLSFLPVGEYKLVVSVGAFGVWRLQVNLF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 23/79 (29%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:461928 27/91 (30%)

Return to query results.
Submit another query.