DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG13193

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:177 Identity:40/177 - (22%)
Similarity:63/177 - (35%) Gaps:64/177 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RFTNVTCE-SKDLSMSIVEYCA-----VTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTRGSES 85
            :|||::.| |||       ||:     :|...:....|.|...:...:.|.|.: .||       
  Fly    36 KFTNISVECSKD-------YCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITL-LQL------- 85

  Fly    86 IHAASNWQPFLHTMKLDLC------------RFWKNHHNHLARMVFEFIDGHTNMNHTCPYTKEK 138
            |.....:|. |.:..:|.|            :.|       .|.||::    .|:...||.....
  Fly    86 IDGKDRYQT-LFSYDMDTCKTLRELLQSSLMKVW-------LRNVFKY----GNLADRCPIQPAS 138

  Fly   139 YISIDDLTNTEVSAKIRGVP--MPKGFYALFTTWSTENITRVVTNFY 183
            |    |:.|.::  :...:|  :|.|||.|..           ||:|
  Fly   139 Y----DVRNFQL--ENHSIPGYLPAGFYRLHD-----------TNYY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 20/94 (21%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 23/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.