DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG33467

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:182 Identity:41/182 - (22%)
Similarity:69/182 - (37%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLGLLLCLL-FLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTN 71
            |:.|.:|.: .:|:...|: :||.|.|:.....:..|. |.|..::.|...::|...::.|:. |
  Fly     6 LVLLSICFIGHMTDSQLVY-KFTKVECQGNQARVKNVS-CNVKPINWNTALVNLDCYLIYPLI-N 67

  Fly    72 IEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHL--ARMVFEFIDGHTNMNHTC-- 132
            ..|..|:..:     ..::.::|||......||.. ....|.|  |.||:|.....||:. :|  
  Fly    68 PTIRVQVFMK-----DYSNQYKPFLIDATFKLCDV-VERKNFLPYAVMVWELFQRFTNVK-SCHI 125

  Fly   133 --------PYTKEKYISIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTENIT 176
                    .|....|:.                |.|.|.|.:...:|..|.|
  Fly   126 SGQLSARNGYLNSSYVP----------------PFPHGQYQISVMFSDSNST 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 20/92 (22%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.