DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and CG30050

DIOPT Version :10

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:45 Identity:13/45 - (28%)
Similarity:17/45 - (37%) Gaps:14/45 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VTTLSKNKN--------------SISLRYAMLKPMFTNIEIYFQL 78
            |.||:||.|              |.::....|.||.|..|.:..|
  Fly   115 VNTLAKNSNAKAWRCPFPKGKFESRNISVTDLPPMLTESEFFVNL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928
CG30050NP_725159.2 DM8 90..177 CDD:214778 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.