DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Indy-2 and CG11262

DIOPT Version :9

Sequence 1:NP_001027201.1 Gene:Indy-2 / 3772456 FlyBaseID:FBgn0260466 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_648617.2 Gene:CG11262 / 39471 FlyBaseID:FBgn0036329 Length:702 Species:Drosophila melanogaster


Alignment Length:559 Identity:108/559 - (19%)
Similarity:190/559 - (33%) Gaps:160/559 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIPLIT------LPILIYGFQ-------TDMAEFKCLWLIVT-MALLWITETLPIYVTALFPLVF 77
            :.||:|      ..:|:.||.       ||.. |..|.:..| :|:|......|...|.:..:.|
  Fly   204 VYPLVTENGVLYAALLLIGFYILIVFELTDRT-FAALMMATTGIAILTALGNRPTLETIISWIDF 267

  Fly    78 CPLLGLVNASIVCKQYFTDTIVVFLGGLIVALGIEYSNLHTRIALRVIRIVGGSPRRLFVGLMSV 142
                              :|:::.||.:|:...:..:.:...:|:...||..|:|..:.:.|.|:
  Fly   268 ------------------ETLILLLGMMILVAIMSETGVFDWMAVLAYRISKGNPWPMLLLLSSI 314

  Fly   143 STFMGLWISNSAGTAMMCPIVKALVNELDTNKIFPVYMTQEEEPVEEGEPPHPSKITVAFYAGIA 207
            :..|...:.|.....:|.||...|...:....  |:.:                 |.|..|    
  Fly   315 TAIMSCMLDNVTMLLLMAPIAIRLCEAMAVQT--PLVL-----------------IVVVMY---- 356

  Fly   208 YASSIGGLGTLIGTGTNLVFRGIYTERFPTSTVEITFANFMFYSIPLMVIVNVTLVIIAFLITHM 272
              |:|||..|.:|...|:    |........:..:.|.:|..:.:|.:::..|....:.::....
  Fly   357 --SNIGGTLTPVGDPPNV----IIATNSEVISAGVDFLDFTIHMLPGVLLAAVAGYAVMYVTMRK 415

  Fly   273 GLFRPNSKTGKIIAE-ANTNRKLMEDV--------LRQ---RHI---------DLGPMSCHE--- 313
            .||:...:..::.|| .|:.|:...|:        :||   |.:         .|..:..|.   
  Fly   416 SLFKLEEQQLELAAERENSRRRSSADITARAEEMRIRQPTGRQLLKPAENYFQTLAHLEAHHRIR 480

  Fly   314 -----IQMAIAFAFMIVLLITRKPGFVPGWSDLINRKVVGSASGLSFIVLLIFALPTQYTFFKYC 373
                 |:......|:|:..:.....|:.|       ..:|..:.|:..:|||.|           
  Fly   481 DKTLLIKCLFTLCFVIIFFLLHSLPFMHG-------ATLGWVAILAAFLLLILA----------- 527

  Fly   374 CGKGPFTAQAIDAILSWEYVLRNIPWGLLFLLGGGFALAVASRETGL-----NIMISKAMQVLIG 433
                  ....|:|||.      .:.|..|..|...|.|..|..:.|.     ::.:...|.|...
  Fly   528 ------KMNDIEAILD------QVEWSALLFLAALFVLTEAVDKLGFIRWLCDLTVKVIMSVEER 580

  Fly   434 LPNIVVQSITFVLANFFSAFNANVVVANIVLPILCEM----SLALELHPLILTLPACLGISMVYF 494
            ....|...|...::...:||..||.|..::|.:..|:    ::::.|.|||..|           
  Fly   581 YQTTVAILIIIWMSAILAAFVGNVPVTTMLLRLNIELHRNDAISVPLTPLIWAL----------- 634

  Fly   495 LPVSTPPNAIVTQYAHIKTKYFACCGIVPTIIGISVALV 533
                               .|.||.|...|:||.|..:|
  Fly   635 -------------------SYGACFGGNGTLIGASANVV 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Indy-2NP_001027201.1 ArsB_NhaD_permease 50..533 CDD:304373 98/521 (19%)
dass 52..532 CDD:273267 97/518 (19%)
CG11262NP_648617.2 ArsB 216..692 CDD:223983 105/547 (19%)
P_permease 220..691 CDD:238536 104/543 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.