DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Indy-2 and CG13801

DIOPT Version :9

Sequence 1:NP_001027201.1 Gene:Indy-2 / 3772456 FlyBaseID:FBgn0260466 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_647714.1 Gene:CG13801 / 38299 FlyBaseID:FBgn0035332 Length:690 Species:Drosophila melanogaster


Alignment Length:529 Identity:107/529 - (20%)
Similarity:179/529 - (33%) Gaps:188/529 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ASIIIPLITLPILIYGFQTDMAEFKCLWLIVTMALLWITETLPIYVTALFPLVFCPLLGLVNASI 88
            |.::|.|..  |:|:.| :|......|...:::|||.:..:.|...|         ::..|:   
  Fly   209 ALLLIGLYA--IIIWEF-SDRILSTLLITAMSLALLTVLGSRPTLET---------IVSWVD--- 258

  Fly    89 VCKQYFTDTIVVFLGGLIVALGIEYSNLHTRIALRVIRIVGGSPRRLFVGLMSVSTFMGLW---I 150
                  .:|:::.||.:|:...:..:.....:|:...||..|. ..|.:||:..  |:||.   :
  Fly   259 ------WETMMLLLGNMIITSRMADTGFFDYLAVVAYRISKGH-AWLLIGLLGF--FVGLTSTVV 314

  Fly   151 SNSAGTAMMCPIVKALVNELDTNKIFPVYMTQEEEPVEEGEPPHPSKITVAFYAGIAYASSIGGL 215
            .|:....:.||.|..|...:|......:                   |.||.||      :|||.
  Fly   315 DNATVVLLFCPPVIRLCEVMDLRTTLVL-------------------IIVAIYA------NIGGS 354

  Fly   216 GTLIGTGTNLVFRGIYTERFPTSTVEITFANFMFYSIPLMVIVNVTLVIIAFLITHMGLF----- 275
            .|.:....|.:   |.|.:. ..:..|.|..|....:|..:|.         |.:..||.     
  Fly   355 ITPVSGPPNTI---IATNKM-VESAGINFVRFSLLMLPTALIC---------LASTFGLIYWTMG 406

  Fly   276 -----------------RPNSKT----------------GKIIAEA-------------NTNRK- 293
                             |.|::|                .|:|..|             |..|| 
  Fly   407 KKIYILDEDQVNLAEKRRENTRTSFDIQLRVAELRRQPRSKVIPPAESYFITLATLEASNFVRKK 471

  Fly   294 --LMEDVLRQRHIDLGPMSCHEIQMAIAFAFMIVLLITRKPGFVPGWSDLINRKVVGSASGLSFI 356
              |:|.:|                 |::|| ....::...|..:||.|       :|..|.||..
  Fly   472 VLLVESLL-----------------ALSFA-AFCFILQSVPWAIPGAS-------LGWISILSAF 511

  Fly   357 VLLIFALPTQYTFFKYCCGKGPFTAQAIDAILSWEYVLRNIPWGLLFLLGGGFALAVASRETGL- 420
            :|||  |..|....|                     |:.::.||::.||...|...:...|.|| 
  Fly   512 LLLI--LIDQKDIIK---------------------VMASVEWGIMLLLASLFIFTMVVDELGLI 553

  Fly   421 ----------NIMISKAMQVLIGLPNIVVQSITFVLANFFSAFNANVVVANIVLPILCEM----S 471
                      .:.:.::.|.::|:      .:...|:...|||..|..||.|::.:..:|    .
  Fly   554 HWLGSQVVSVILRVDESYQTMVGM------LLILWLSALLSAFIHNAAVAPIMVKLCTDMVVYDQ 612

  Fly   472 LALELHPLI 480
            :.:.|.|||
  Fly   613 VQMPLLPLI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Indy-2NP_001027201.1 ArsB_NhaD_permease 50..533 CDD:304373 100/503 (20%)
dass 52..532 CDD:273267 99/501 (20%)
CG13801NP_647714.1 ArsB 208..682 CDD:223983 107/529 (20%)
P_permease 212..681 CDD:238536 106/526 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.