DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Indy-2 and hoe2

DIOPT Version :9

Sequence 1:NP_001027201.1 Gene:Indy-2 / 3772456 FlyBaseID:FBgn0260466 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_608878.1 Gene:hoe2 / 33700 FlyBaseID:FBgn0031649 Length:846 Species:Drosophila melanogaster


Alignment Length:535 Identity:105/535 - (19%)
Similarity:183/535 - (34%) Gaps:168/535 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIPLITLPILIYG-FQTDMAEFKCLWLIVTMALLW-----ITETLPIYVTALFPLVFCPLLGLVN 85
            :|.||...:|::. |:.......|..|.||....:     :.|.:......|..|:||.:|.:: 
  Fly   348 VILLIFYALLVWELFERTFVAMICSILSVTTLACFNDRPNMDEIIQWMDMELLTLLFCMMLLIL- 411

  Fly    86 ASIVCKQYFTDTIVVFLGGLIVALGIEYSNLHTRIALRVIRIVGGSPRRLFVGLMSVSTFMGLWI 150
                   ..|:|.|           .:|      :|:....|.||....:...|..|:..:...:
  Fly   412 -------ILTETGV-----------FDY------LAVFCFEISGGKIWPMIYSLCLVTCLVSSVL 452

  Fly   151 SNSAGTAMMCPIVKAL--VNELDTNKIFPVYMTQEEEPVEEGEPPHPSKITVAFYAGIAYASSIG 213
            .|.....::.|:...|  |.:||.   .||.|                        ||...::||
  Fly   453 DNMTTVLLLTPVAIRLCEVMQLDP---LPVVM------------------------GIIVHANIG 490

  Fly   214 GLGTLIGTGTNLVFRGIYTERFPTSTVEITFANFMFYSIPLMVIVNVTLVIIAFLITH------- 271
            |..|.||...:::   :.|..|.... ::||..|:.::.|.:::..:...:...|..|       
  Fly   491 GALTPIGDPISII---VSTNHFIVDN-DVTFPTFVAHTFPGVILAVIQSCVYLRLFYHNIDALRL 551

  Fly   272 -----MGLFRPNSKT-----------------------GKIIAEANTNRKLME------------ 296
                 |...|...|.                       .||.....|.|:|.:            
  Fly   552 NEPKEMSELRREMKVWQRALNAVASCSKDAQLVRGTLQAKIKQLKRTLRRLQKGVGSTEVYTNTL 616

  Fly   297 DVLRQRHIDLGPMSCHE--IQMAIAFAFMIVLLITRKPGFVPGWSDLINRKVVGSASGLSFIVLL 359
            |.|:|::    |:....  :|.|.|..|:||....:.   ||.|..|    .:|..:.|..|:||
  Fly   617 DELKQKY----PIKNKTLLLQSAGALLFVIVCFFIQS---VPHWRTL----PLGWVALLGVILLL 670

  Fly   360 IFALPTQYTFFKYCCGKGPFTAQAIDAILS---WEYVLRNIPWGLLFLLGGGFALAVASRETGLN 421
            |                          ||:   .|:::..|.|..|......|.:.......|:.
  Fly   671 I--------------------------ILNRDDMEHLMHRIEWTTLLFFAAMFVMMECVERLGIF 709

  Fly   422 IMISKAMQ---VLIGLPNIVVQSITFVLANFFSAFNANV--------VVANIVLPILCEMSLALE 475
            ..||:..:   :.:|..:.:..:|..:|  :.||..:::        ::..:|..::.:.||.|.
  Fly   710 ACISELTEHVILSVGKSHRLAMAIFMIL--WMSALASSILDSIPVAAIMVKLVTSLVAKPSLGLP 772

  Fly   476 LHPLI--LTLPACLG 488
            |.||:  |||.|.:|
  Fly   773 LQPLVWALTLGASMG 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Indy-2NP_001027201.1 ArsB_NhaD_permease 50..533 CDD:304373 99/511 (19%)
dass 52..532 CDD:273267 99/509 (19%)
hoe2NP_608878.1 ArsB 343..837 CDD:223983 105/535 (20%)
P_permease 350..837 CDD:238536 104/533 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.