DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Indy-2 and CG31693

DIOPT Version :9

Sequence 1:NP_001027201.1 Gene:Indy-2 / 3772456 FlyBaseID:FBgn0260466 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_724369.2 Gene:CG31693 / 318887 FlyBaseID:FBgn0051693 Length:688 Species:Drosophila melanogaster


Alignment Length:598 Identity:117/598 - (19%)
Similarity:210/598 - (35%) Gaps:177/598 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SIIIPLITLPILIYGFQTDMAEFKCLWLIVTMALLWITETLPIYVTALFPLV---FCPLLGLVNA 86
            |:.:.:.|.|::     |||. ..|..|::          |.:|:..:|.::   |..|:....|
  Fly   182 SLHVVIDTNPMV-----TDMC-LVCAGLLI----------LGLYMLIIFDVIDHTFAALIIATTA 230

  Fly    87 --------------SIVCKQYFTDTIVVFLGGLIVALGI-EYSNLHTRIALRVIRIVGGSPRRLF 136
                          :||....|...:::|  ||:..:.| ..:.:...:.:...||..|.|..|.
  Fly   231 VAILAILEHRPSMRAIVSFVNFEPLMLLF--GLMTIVDIMATTGVFDFLVVWTYRISRGRPWPLI 293

  Fly   137 VGLMSVSTFMGLWISNSAGTAMMCPIVKALVNELDTNKIFPVYMTQEEEPVEEGEPPHPSKITVA 201
            ..|..::.|:..::::......:.||...|..|:.....:.:                   :.:|
  Fly   294 FFLSMLTAFLSAFLNSDIMALSLTPITIRLCEEMSLRTSYVL-------------------VVMA 339

  Fly   202 FYAGIAYASSIGGLGTLIGTGTNLVFRGIYTERFPTSTVE-ITFANFMFYSIPLMVIVNVTLVII 265
            .:|      .:||..|.:|...|.:   :.|.  |.:..| :.||:|:.:.:| .|:..:.:|..
  Fly   340 IFA------DMGGALTPLGNPPNAI---VTTS--PVAVAEGVDFAHFIIHMMP-GVLAAMFVVFG 392

  Fly   266 AFLITH-------------------MGLFRPNSKT------------GK-----------IIAEA 288
            ...:||                   .|...|:.:|            ||           .:||.
  Fly   393 IIYVTHRKSIFVLDQNQLDLMEERARGKKPPSQETLDRIALLKGSLPGKYWLRPVEGYPETLAEL 457

  Fly   289 NTNRKLMEDVLRQRHIDLGPMSCHEIQMAIAFAFMIVLLITRKPGFVPGWSDLINRKVVGSASGL 353
            ..:.::::..|..|       .|    :|:.|||:.:||.:     :|        ||...|| |
  Fly   458 EASSRILDKPLLVR-------CC----IALIFAFLCMLLHS-----IP--------KVADGAS-L 497

  Fly   354 SFIVLLIFALPTQYTFFKYCCGKGPFTAQAIDAILSWEYVLRNIPWGLLFLLGGGFALAVASRET 418
            .::.||                 ..|....:|........|..|.|.:|..:...|.|:.|..:.
  Fly   498 GWVTLL-----------------AAFLLIILDDKNDLNATLGIIQWTILLFIAALFVLSEAVDQL 545

  Fly   419 G---------LNIMISKAMQVLIGLPNIVVQSITFVLANFFSAFNANVVVANIVLPILCEMSL-- 472
            |         :..:.|...|..|.:..:|:...|.:|..|..    |..|...:|....||:.  
  Fly   546 GFFEWLGDRTVGFLRSLEPQNQIAVTTMVILWTTALLTIFID----NAAVTIFMLKFSIEMASND 606

  Fly   473 ALELHPLI--LTLPACLGISMVYFLPVSTPPNAIVT-QYAH-IKTKYFACCG----IVPTIIGIS 529
            .:.|.|:.  ||..||.|.:...|..||....|::. |:.: |...:|...|    :|..:||..
  Fly   607 DIPLPPMFWALTFGACFGGNGSLFGAVSNEIIALIALQHGYKISFWHFFAIGFPLMLVTMVIGSG 671

  Fly   530 VALV--NTNTWGL 540
            ..|:  :..:|.|
  Fly   672 YLLIAHSVLSWNL 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Indy-2NP_001027201.1 ArsB_NhaD_permease 50..533 CDD:304373 107/562 (19%)
dass 52..532 CDD:273267 107/559 (19%)
CG31693NP_724369.2 ArsB 196..675 CDD:223983 109/568 (19%)
P_permease 205..674 CDD:238536 106/557 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.