DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9133 and CG9129

DIOPT Version :9

Sequence 1:NP_001027093.1 Gene:CG9133 / 3772453 FlyBaseID:FBgn0035198 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_612088.2 Gene:CG9129 / 38138 FlyBaseID:FBgn0035196 Length:251 Species:Drosophila melanogaster


Alignment Length:214 Identity:37/214 - (17%)
Similarity:66/214 - (30%) Gaps:87/214 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ACDCDCSPELAPCFIQPTKPDPGPEAYDEFEACLNGSGLTIRVLKNTHKVESVMDGSETAPNLGA 109
            :|...|||:...|                          |:..|::....|.||           
  Fly    62 SCVNPCSPKCGKC--------------------------TLFTLESPITDEDVM----------- 89

  Fly   110 GDDPCYRDDPNDCE--------PAKESCLHDMLQRSSFARN---------HIKRRTGGRIINHPN 157
             ....|:.....|:        |.|.  :.|.:::..:::|         |:.|           
  Fly    90 -HIHVYKKRTESCKFLLGLTELPMKP--IFDRVKKEFYSQNINWESNVESHLSR----------- 140

  Fly   158 IPKVRANIKYSGNDAC-----ETDNYYVPFSKIKE-------ACDFQEAKVDCYRQRLCGGSDPI 210
            :||:|...|.:.:..|     |....:.|.|::.:       .|..|...:....:.:|.|  |.
  Fly   141 MPKLRGPCKKANDCVCYERNRERREQWCPTSELTKRMLPLFNLCKMQTGNIVLILRLVCNG--PS 203

  Fly   211 VPAHCPVQ-----NQRSCC 224
            |.:..|||     :..:||
  Fly   204 VVSSFPVQRPVCKDPCNCC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9133NP_001027093.1 None
CG9129NP_612088.2 DUF4497 70..205 CDD:291585 27/187 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8Z4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.