DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG13250

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:132 Identity:26/132 - (19%)
Similarity:56/132 - (42%) Gaps:14/132 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVSLLLLMLIVKEI--KPR-------VEFTNLKCRSVNKDFAEFTQCTLKSI-NRTYKYISTKVS 63
            |..||:|..:|..|  :|.       :.:.::.|..::...||..:|.:..: .:...:::|.:.
  Fly     7 LRGLLILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLL 71

  Fly    64 LHKLPITKARVNFGLYKRFNGY-RPF--LYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHS 125
            |.: .:||..|...:.:..|.. ||.  |:...:|.||..:.:..:.:.......:.:..|...:
  Fly    72 LRR-SVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDA 135

  Fly   126 CP 127
            ||
  Fly   136 CP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 11/57 (19%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.