DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33721

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:180 Identity:64/180 - (35%)
Similarity:106/180 - (58%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYTKLTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHK 66
            ||:|...|..|::....:.|...::||||.||...:..:..|..|.:||:||||||||.|.::::
  Fly     1 MYSKAAKLFVLVIFFGNIMENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYE 65

  Fly    67 LPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQK--ANPVAKYFFDMIKEYSNLNHSCPYN 129
            :|||.|.....:.:||..|.|.....::|.|.:..::|  |||:.:.|.::.|:|:|.||.|||:
  Fly    66 VPITNASAKLQISRRFRSYMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYD 130

  Fly   130 NDIIVEKVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITL 179
            :|:|::::.:..::.|.|.|||.|.|||...:.|...:|....|.:|.|:
  Fly   131 HDLIIDRLPSKYLSEHFTNILPLPPGDYSFNSIWYSRNIERATISIYYTV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 30/86 (35%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.