DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG13590

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:169 Identity:58/169 - (34%)
Similarity:87/169 - (51%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKARV 74
            ||||:..|...| .|.::.||..|:|.||.:.....|.||:.:|....::..|:..: |.....|
  Fly    10 VSLLVAYLSCGE-APYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVE-PARNISV 72

  Fly    75 NFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKVST 139
            :|...|:.|||:|||::.|.|||.|.: ::..||||..:.||:..|.:||:|||      |.:..
  Fly    73 HFKTMKKANGYKPFLFDYTFDACEFMR-RRNQPVAKIIWYMIRNVSTINHTCPY------EGLQM 130

  Fly   140 DTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYIT 178
            .:..|.|...:|.|.|||:|...|:.:........||.|
  Fly   131 LSDFHKVDIPVPLPSGDYLLMVDWLFDGKTQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 34/84 (40%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 34/94 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472596
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.