DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG13561

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:177 Identity:46/177 - (25%)
Similarity:86/177 - (48%) Gaps:10/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKLTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLP 68
            |:|.||..|..::    :::...:|||::|.|.:::|...:.|.|.::.|....:|.:.::.:.|
  Fly     5 TELFLLFGLWHIL----QVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWP 65

  Fly    69 ITKARVNFGLYKRFNGYRPFLYN-KTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDI 132
            .....:...|.|:.:||:||||| ...|.|.:.: ::.:|............:|:| .||...:|
  Fly    66 KGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLE-KRNHPFINIILSSFGNRTNVN-KCPIPPEI 128

  Fly   133 IVEKVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITL 179
            ::|......   .|..::|.|.|||.|.|.:..:......::||.||
  Fly   129 VLEHFRFPV---KVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 24/85 (28%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472594
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.