DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33725

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:175 Identity:52/175 - (29%)
Similarity:89/175 - (50%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYTKLTLLVSLLLLMLIVKEIKPRV--EFTNLKCRSVNKDFAEFTQCTLKSINRTYKYIS-TKVS 63
            |.:||...:..:.:.::|.::...|  :|||..|.|.|:.:..|..|.||:::|....:: ....
  Fly     1 MLSKLVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTV 65

  Fly    64 LHKLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPY 128
            ||  |.....|:..|:|:.||::|:|.:..||||.|.: ...:|..:..||:.|::|.:||:|||
  Fly    66 LH--PANNIIVHVKLFKKANGFKPWLLDVKLDACRFVR-TNFHPFVRIIFDLFKDFSTINHTCPY 127

  Fly   129 NNDIIV-------EKVSTDTVNHHVTKILPYPEGDYMLETHWMLN 166
            ....:|       ||:.           ||:|.|||:|...|:.:
  Fly   128 VGLQVVKDFYLRPEKLK-----------LPFPSGDYLLSLIWIFD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 31/91 (34%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.