DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33644

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:131 Identity:31/131 - (23%)
Similarity:53/131 - (40%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TNLKCRSVNKDFAEFTQCTL--KSINRTYKYISTKVSLHKLPITKARVNFGLYKRFNGYRPFLYN 91
            |.::|...:.::.:...|.|  ||.|...|..|.:.||.| .:...|   |.|.........:.|
  Fly     6 TQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRK-EVNDVR---GAYVFSFKQGKSIIN 66

  Fly    92 KT---LDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEK---VSTDTVNHHVTKIL 150
            .|   :|.|......::..:.|...|.::..||...:||:    ::.|   |...|:|   .|::
  Fly    67 YTAMEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPF----VMNKRYYVDEFTIN---PKVI 124

  Fly   151 P 151
            |
  Fly   125 P 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 18/84 (21%)
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.