DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33796

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:177 Identity:58/177 - (32%)
Similarity:94/177 - (53%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMYTKLTLLVSL-LLLMLIVKEIKPRV-EFTNLKCRSVNKDFAEFTQCTLKSINR---------T 54
            |.|. |.::||| :|.::|:|...|.| :.||:.|.|.||.:....||.||:|||         |
  Fly     1 MKYV-LKIVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNAT 64

  Fly    55 YKYISTKVSLHKLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEY 119
            :.|.:..:::|          :..:||.|||||:|.|..:|.|.|.: :..:.:....|::.:.:
  Fly    65 FLYPTKSITVH----------YQTFKRENGYRPWLVNTQIDGCRFLR-KPYDALGILLFNIYRNF 118

  Fly   120 SNLNHSCPYNNDIIVEK--VSTDTVNHHVTKILPYPEGDYMLETHWM 164
            :|:||:||...|:||..  ::||.:.      ||.|.|||:|...|:
  Fly   119 TNINHTCPLQGDMIVRNMYLTTDVMR------LPLPTGDYLLAIDWI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 29/86 (34%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.