DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33453

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:174 Identity:56/174 - (32%)
Similarity:95/174 - (54%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVS-LHKLPITK 71
            :.::.|.|:..|.| .|.::.||:.|.|:||.:|.|..|.||:.:|....::...: ||  |...
  Fly    10 VFLAALFLISSVSE-APNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH--PTNN 71

  Fly    72 ARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEK 136
            ..:...:.||.:||:|||::.|:|||.|.: ::.|||.|.|:..||:||.|||:|||...::.: 
  Fly    72 VSLRLKMVKRLSGYKPFLFDVTIDACQFLR-KRHNPVIKMFYSFIKDYSTLNHTCPYGLQVVSD- 134

  Fly   137 VSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITLF 180
                  .|.....:|.|.|||.:    :|:.|:....|.::.::
  Fly   135 ------YHTAVFPVPLPSGDYGV----LLDFIFYAKKQFHVNIY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 33/84 (39%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472598
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.