DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33454

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:187 Identity:63/187 - (33%)
Similarity:95/187 - (50%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYTKLTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLH- 65
            |...:.:|...:.::.:|......|:.||:.|.|.:|....|..|.||:.:|      ||.||| 
  Fly     1 MLANVIILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSR------TKTSLHI 59

  Fly    66 ----KLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSC 126
                ..||....|.|.:.||.|||:|||::.|:|||.|.: :..|||.|..::|||:.||:||||
  Fly    60 NATFLHPINSISVRFQMLKRANGYKPFLFDITVDACQFLR-KPNNPVIKIVYNMIKDASNINHSC 123

  Fly   127 PYN----NDIIVEKVSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITL 179
            ||.    ||.           |.::..||:|.|||:....:::|    |..:.|:.:
  Fly   124 PYGTVVLNDF-----------HRISLPLPFPSGDYLSRLDFLIN----GKTKFYVNV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 39/88 (44%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472592
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.