DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33723 and CG33483

DIOPT Version :9

Sequence 1:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:159 Identity:77/159 - (48%)
Similarity:112/159 - (70%) Gaps:0/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKARVNFGLYKRFNGY 85
            :|...|||||:||.|.:|.|.:|..|.|||:||::||:|.||:|||:||||.:|||.|.||||||
  Fly    70 KIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGY 134

  Fly    86 RPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKVSTDTVNHHVTKIL 150
            :|||||.|:|||...:|.|.||:..:|:.:.|.:||:||:||:::|:||||:.|:.:|..|...:
  Fly   135 KPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDI 199

  Fly   151 PYPEGDYMLETHWMLNDIYCGVIQVYITL 179
            .:|.|||:..:.|....|....:..::||
  Fly   200 KFPHGDYLFHSDWYAYGINRATVDFFLTL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 43/84 (51%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 43/84 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472113
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.