DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14245 and CG3348

DIOPT Version :9

Sequence 1:NP_001287548.1 Gene:CG14245 / 3772449 FlyBaseID:FBgn0039452 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001303428.1 Gene:CG3348 / 50082 FlyBaseID:FBgn0040609 Length:98 Species:Drosophila melanogaster


Alignment Length:74 Identity:20/74 - (27%)
Similarity:40/74 - (54%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GQPGCQTAEELEVAFYAHFYLKSSYWVCSTQGVPATLAQCPIASAWLDSAKACVPWPQWVWSPTV 93
            |:|.||..:|:. ..:.:::..::||||..||..|.|.:||.:..:.:....||.:..|.|:...
  Fly    20 GEPSCQGLDEVN-RMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADWAWTDPK 83

  Fly    94 QPPSQPEVA 102
            :|..:.:::
  Fly    84 EPAGRAKIS 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14245NP_001287548.1 None
CG3348NP_001303428.1 ChtBD2 24..73 CDD:214696 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26159
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.