DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14245 and CG14300

DIOPT Version :9

Sequence 1:NP_001287548.1 Gene:CG14245 / 3772449 FlyBaseID:FBgn0039452 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001014639.1 Gene:CG14300 / 3346166 FlyBaseID:FBgn0038643 Length:94 Species:Drosophila melanogaster


Alignment Length:95 Identity:29/95 - (30%)
Similarity:44/95 - (46%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLPLFAFFLILGYSSFCSGAAVAKPTGQPGCQTAEELEVAFYAHFYLKSSYWVCSTQGVPATLAQ 67
            |..:.|..|:.|         |:...|:..|:...|:... |.|.:..:.||:|.|.|||||...
  Fly     8 FATVLAIILVAG---------VSADAGRSACKDESEIGQT-YTHHFDAAKYWLCETLGVPATEVD 62

  Fly    68 CPIASAWLDSAKACVPWPQWVWSPTVQPPS 97
            ||...|::...|.|:||..::|.....||:
  Fly    63 CPAGLAYMHLLKECIPWASYIWKKPEMPPT 92



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.