DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33829 and si:dkey-261m9.11

DIOPT Version :10

Sequence 1:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_009296467.2 Gene:si:dkey-261m9.11 / 563177 ZFINID:ZDB-GENE-131127-102 Length:266 Species:Danio rerio


Alignment Length:125 Identity:112/125 - (89%)
Similarity:119/125 - (95%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:||||||||||||||||||||||||:|||.||:||
Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||||.|
Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 99/107 (93%)
si:dkey-261m9.11XP_009296467.2 PTZ00017 1..121 CDD:185399 107/119 (90%)
PTZ00017 139..266 CDD:185399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.