DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33829 and htas-1

DIOPT Version :9

Sequence 1:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_501718.1 Gene:htas-1 / 191549 WormBaseID:WBGene00014240 Length:145 Species:Caenorhabditis elegans


Alignment Length:124 Identity:62/124 - (50%)
Similarity:82/124 - (66%) Gaps:2/124 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYA-ERVGAGAPVYLAAVMEYLAAEVLEL 65
            |.:....|.|.|..|||.|:||.||||||||.||:.... :|:.|||.|::||.:|||..|::|:
 Worm    15 STKTSSAKKKKKRISRSTRSGLTFPVGRIHRKLRETTRGKQRISAGASVFMAATLEYLTTELMEM 79

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLP-NIQAVLLPKKTEKK 123
            :..||.::||:|:.||||.|||..|:|..:||..||:.||||.| .|...|||||..|:
 Worm    80 SAIAANESKKSRVTPRHLHLAIYGDQETAQLLDKVTLPQGGVTPMPIHPSLLPKKKAKE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 58/110 (53%)
htas-1NP_501718.1 H2A 27..132 CDD:238029 53/104 (51%)
H2A 29..132 CDD:197711 53/102 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.