DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33829 and h2ac17

DIOPT Version :9

Sequence 1:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_012811817.1 Gene:h2ac17 / 100127770 XenbaseID:XB-GENE-5861673 Length:156 Species:Xenopus tropicalis


Alignment Length:126 Identity:95/126 - (75%)
Similarity:109/126 - (86%) Gaps:7/126 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVK----GKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE 61
            ||||||  ||:    ||: |||.:||||||||||||||||||||||:|:|:.:||||.:|||.||
 Frog    19 MSGRGK--KVQKAASGKS-SRSAKAGLQFPVGRIHRLLRKGNYAERIGSGSAIYLAATLEYLCAE 80

  Fly    62 VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122
            ||||||||||||||:||:|||:|||:|||:||.||..|||||.||||||||:.||||||.|
 Frog    81 VLELAGNAARDNKKSRILPRHIQLAVRNDDELAKLFDGVTIADGGVLPNIQSALLPKKTVK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 85/107 (79%)
h2ac17XP_012811817.1 H2A 24..138 CDD:238029 86/116 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.