DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33829 and h2ac17

DIOPT Version :10

Sequence 1:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_012811817.1 Gene:h2ac17 / 100127770 XenbaseID:XB-GENE-5861673 Length:156 Species:Xenopus tropicalis


Alignment Length:126 Identity:95/126 - (75%)
Similarity:109/126 - (86%) Gaps:7/126 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVK----GKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE 61
            ||||||  ||:    ||: |||.:||||||||||||||||||||||:|:|:.:||||.:|||.||
 Frog    19 MSGRGK--KVQKAASGKS-SRSAKAGLQFPVGRIHRLLRKGNYAERIGSGSAIYLAATLEYLCAE 80

  Fly    62 VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122
            ||||||||||||||:||:|||:|||:|||:||.||..|||||.||||||||:.||||||.|
 Frog    81 VLELAGNAARDNKKSRILPRHIQLAVRNDDELAKLFDGVTIADGGVLPNIQSALLPKKTVK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 85/107 (79%)
h2ac17XP_012811817.1 PTZ00017 19..149 CDD:185399 95/126 (75%)

Return to query results.
Submit another query.