DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33829 and H2al1c

DIOPT Version :10

Sequence 1:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001229878.1 Gene:H2al1c / 100042929 MGIID:3711280 Length:105 Species:Mus musculus


Alignment Length:96 Identity:32/96 - (33%)
Similarity:55/96 - (57%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRII 79
            ::||.|..|.|.:  :.|.||:..::.|:.:.|..:|.:|:|||.:.:|||||..|:...:.||.
Mouse    13 RTRSQRGELPFSL--VDRFLREEFHSSRLSSSALSFLTSVLEYLTSNILELAGEVAQTTGRKRIA 75

  Fly    80 PRHLQLAIRNDEELNKLLSGVTIAQGGVLPN 110
            |..::|.::|:|:|.:|..     .||...|
Mouse    76 PEDVRLVVQNNEQLRQLFK-----PGGTSVN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 32/95 (34%)
H2al1cNP_001229878.1 HFD_SF <50..94 CDD:480273 18/43 (42%)

Return to query results.
Submit another query.