DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11891 and CG31370

DIOPT Version :9

Sequence 1:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:401 Identity:111/401 - (27%)
Similarity:175/401 - (43%) Gaps:62/401 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPAWLTRDYVEQKLRSYFRNDSLRLVNLDIKLALGNGENYSSVITRIYVEYTTDKSKDKQS---- 72
            ||.||...:|...|||:.:...||:..||.......|:||:|||.|..|||.|.|....:|    
  Fly    12 VPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIK 76

  Fly    73 TRFTRFADAGPAAQVLLSYGVYNRELDLYERILPQMAEVVRNELADSRKLFAGTVYVDRKRDSI- 136
            |....||.:          .::..|:.:|.::||:.|.::| |..|:.:|:|..:|...:...: 
  Fly    77 TVLEMFAGS----------ALFKTEIGMYRKVLPEFARILR-ENNDTSRLYAECIYYSLEPSQVM 130

  Fly   137 IFEDMSLENY-RVADRLKKLDLEHTHL--VLEKLANFHAAGAALAERQPGIFAKNFDRGFFNQHT 198
            ||||:...:| .|.||:    |.|..:  ...|||.|||....:...:|. |.|.|..|......
  Fly   131 IFEDLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINERPE-FVKEFKDGICLVDI 190

  Fly   199 RGYEPIMKNLLMALSRSLELEPDLCQRYQAK--------IDRLVENVMEYGERSTTIVPGDFLTL 255
                |.|.:.:......|...|:| .||:..        ||||.:.:.||   .|...|| :..|
  Fly   191 ----PYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEY---QTNPQPG-YYVL 246

  Fly   256 AHGDLWTTNIMFQYD-DKGHPINAIFIDFQFSAWNSP-AIDLHYFFSTALQADIRLKKQPELVQF 318
            .|||..|.|||.::: :.|...:.:.:|:| ..:.:| |.||.|.....:..:.|:.:...|:.:
  Fly   247 CHGDYHTRNIMVKHNKESGGFEDCMLLDYQ-GCYVAPLAFDLMYSIYMLMNREQRIGELETLLNY 310

  Fly   319 YYYKLNAALKKVQYSGNVPSLFVF-HQQFRNRSFYAAFASLIFEPTMTY----------TGKEEA 372
            |:..|...|:|:.|.|.:|....| .:.:|.:.:...|.|       ||          |...|.
  Fly   311 YFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLS-------TYLPMSVGLSLETATNEE 368

  Fly   373 SMDQIISLSEK 383
            :.|::....|:
  Fly   369 TDDKLQDFIEE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11891NP_001027211.3 None
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 86/302 (28%)
APH <202..320 CDD:279908 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.