DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11891 and CG6834

DIOPT Version :9

Sequence 1:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:417 Identity:110/417 - (26%)
Similarity:199/417 - (47%) Gaps:22/417 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PAWLTRDYVEQKLRSYFRNDSLRLVNLDIKLALGNGENYSSVITRIYVEY-TTDKSKDKQSTRFT 76
            |.||.:...|:.|.::....| ::|...:|.|:..||||::::.||.::. .|||     ||:..
  Fly    62 PEWLNQTQFEELLAAHVDQFS-KIVGFQVKPAMAPGENYATLMLRISIDVELTDK-----STKLV 120

  Fly    77 RFADAGP-----AAQVLLSYGVYNRELDLYERILPQMAEVVRNELAD---SRKLF-AGTVYVDRK 132
            .|....|     ..|:|.....:|.|..:|..|||::.|:.:.:..|   :.|.| ..:|...:.
  Fly   121 CFMLKVPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEPKL 185

  Fly   133 RDSIIFEDMSLENYRVADRLKKLDLEHTHLVLEKLANFHAAGAALAERQPGIFAKNFDRGFFNQH 197
            .::::..|:|.:.::..:||:.|:||.|...|:|||.|||| :::..:..|.:...|..|....:
  Fly   186 ANTVLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAA-SSMNVQVNGPYEDQFVNGVMGGN 249

  Fly   198 TR----GYEPIMKNLLMALSRSLELEPDLCQRYQAKIDRLVENVMEYGERSTTIVPGDFLTLAHG 258
            ..    .||.::.:...||..:|:...: .:.::.|:::....:....|...|..|.:|..|.||
  Fly   250 KEVLMAFYEGMVASFRTALMANLKNFKN-GEEFREKLEKAFVQIFLDFEHLMTADPDEFNVLNHG 313

  Fly   259 DLWTTNIMFQYDDKGHPINAIFIDFQFSAWNSPAIDLHYFFSTALQADIRLKKQPELVQFYYYKL 323
            |.|..|::|:.|.||...:.:|:|||...:.||..||.|...|::..|.:|......::.|:.:|
  Fly   314 DCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHEQL 378

  Fly   324 NAALKKVQYSGNVPSLFVFHQQFRNRSFYAAFASLIFEPTMTYTGKEEASMDQIISLSEKGMRFK 388
            ...|..:.::|..|||...|........:|.|.|:...|.:.....|.|:.:..:..||...:||
  Fly   379 TQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSESSAKFK 443

  Fly   389 DDAFQAEETRKKMRLTLPFLDHLGLLD 415
            :..:..:.....:...||:||:.|.|:
  Fly   444 NLLYTNKRYHGYIEKLLPWLDNKGFLE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11891NP_001027211.3 None
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 80/298 (27%)
EcKinase 529..813 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.