DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11891 and CG5126

DIOPT Version :9

Sequence 1:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:449 Identity:95/449 - (21%)
Similarity:171/449 - (38%) Gaps:114/449 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DYVEQKL-RSYFRN----------------------DSLRLVNLDIKLALGNGENYSSVITRIYV 60
            ||:|:.| ...|:|                      .:|..|.||:.:|    |...:.:  :.|
  Fly     9 DYIERHLVYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIA----ERKRTEV--VLV 67

  Fly    61 EYTTDKSKDKQSTRFTRFADAGPAAQVLLSYGVYNRELDLYERILPQMAEVVRNELADSRKL--- 122
            ::.....:.::|:.               ||..::.|:..|..|||....|:|....:|..:   
  Fly    68 KFMKGTEEFRESSN---------------SYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNW 117

  Fly   123 -----FAGTVYVD---RKRDSII-FEDMSLENYRVADRLKKLDLEHTHLVLEKLANFHAAGAALA 178
                 ||...:|:   ..|:|:: .:.:..:.|::..|| .|..:....::..:..|||.|.|..
  Fly   118 VPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGPRL-TLRRDQLEAMVGLVGPFHALGYATK 181

  Fly   179 ERQPGIFAK----NFDRGFFNQHTRGYEPIMKNLLMALSRSLEL----EPDLCQ----RYQAKID 231
            ..||.:.|:    ..|..|.:...:|...::..  :|..|..|.    :..|.|    .:.|.|:
  Fly   182 ILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYR--VAFDRFYEFYDRQKEQLLQGADPGFGAAIE 244

  Fly   232 RLVENVMEYGERSTTIV-------------PGDFLTLAHGDLWTTNIMFQY--DDKGHPINAIFI 281
            ||.|   :|.::.|.::             ...|.|..|||....|::|.|  :||...|.|  |
  Fly   245 RLRE---KYFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKA--I 304

  Fly   282 DFQFSAWNSPAIDLHYFFSTALQADIRLKKQPELVQFYYYKLNAALKKV---------------- 330
            |||...:::.||||.:|......::.|.:...:|::.|:..:...|:.|                
  Fly   305 DFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQL 369

  Fly   331 --QYSGNVPSLFVFHQQFRNRSFYAAFASLIFEPTMTYTGKEEASMDQIISLSEKGMRF 387
              :|     |...|:..|:..:||.....:.|.|.:..|.|:.|.:.::......|..|
  Fly   370 LQEY-----SFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHGPAF 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11891NP_001027211.3 None
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 75/340 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.