DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11891 and CG7135

DIOPT Version :9

Sequence 1:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:426 Identity:113/426 - (26%)
Similarity:183/426 - (42%) Gaps:40/426 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PAWLTRDYVEQKLRSYFRNDSLRLVNLDIKLALGNGENYSSVITRIYVEYTTDKSKDKQSTRFTR 77
            |.:||..:..:.|....:...|:::.:.:......||||.|.|.|..::|...:|...:::...:
  Fly     9 PLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLIVK 73

  Fly    78 -FADAGPAAQVLLSYGVYNRELDLYERILPQMAEVVRNELADS-------RKLFAGTVYVDRKRD 134
             ..|...|  :|....:||:|...|..|.|:: |.:.....||       .|.:..|.   :...
  Fly    74 SMPDEKQA--ILARLHIYNKETLFYMHIKPKL-EALMWRAVDSFSAWTLAPKHYYSTT---QPEQ 132

  Fly   135 SIIFEDMSLENYRVADRLKKLDLEHTHLVLEKLANFHAAGAALAERQPGIFAKNFDRGFFNQHTR 199
            :||.||:....|::..|...||.:|..||:.|||.:||....:|||:|......:..|..:....
  Fly   133 TIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAI 197

  Fly   200 GYEPIMKNLLMALSRSLELEPDLCQRY---QAKIDRLVENVMEYGERSTTIVPGDFLTLAHGDLW 261
            ..||........|.:...|..| |:.:   ..|:.|..|:..|...::...:.|:...|.|||||
  Fly   198 NSEPFKLLFGTQLLKLAALVGD-CEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLW 261

  Fly   262 TTNIMFQYDDKGHPINAIFIDFQFSAWNSPAIDLHYFFSTALQADIRLKKQPELVQFYYYKLNAA 326
            ..||.|:||.:........||||...:.|...|::||.:|:|:.::...::.|||..||..|...
  Fly   262 VNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDC 326

  Fly   327 LKKVQYSGNVPSLFVFHQQFRNRSFYAAFASLIFEPTMTYTG--KEEASMDQIISLSEKGMRFKD 389
            ||.:.:|..:||......:.|.|..|..|.:..|.|.|:..|  .|:.|:          ..|.|
  Fly   327 LKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSL----------KNFHD 381

  Fly   390 DAFQAEE----------TRKKMRLTLPFLDHLGLLD 415
            :.|..::          |.:.::.||..||.|.|.|
  Fly   382 ETFARQKVQLMFEGNTRTLESLKCTLKRLDELKLFD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11891NP_001027211.3 None
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 84/293 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
55.010

Return to query results.
Submit another query.