DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11891 and E02C12.10

DIOPT Version :9

Sequence 1:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_505430.3 Gene:E02C12.10 / 183989 WormBaseID:WBGene00017095 Length:417 Species:Caenorhabditis elegans


Alignment Length:237 Identity:54/237 - (22%)
Similarity:87/237 - (36%) Gaps:66/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 KNFD-----RGFF------NQHT-RGYEPIMKNLLMALSRSLELEPDLCQRYQAK---------I 230
            |.||     :||.      |.|: ..||.|..:.|::|.|.:.....|.:..:..         |
 Worm   141 KPFDDANDLKGFMIMEFIPNVHSIPMYEAIPADDLISLVRGIATFAALGETSEGDKTSAGGPEFI 205

  Fly   231 DRLVENVME--------------YG-------ERSTTIVP----------------GDFLTLAHG 258
            |.:.|.|:.              ||       |.|.||:.                |..|.|.||
 Worm   206 DMMFEEVLSMDQIEGHFDSLRILYGSEHLNTVETSITILRQYRMITKKYTKISELLGFKLVLNHG 270

  Fly   259 DLWTTNIMFQYDDKGHPINAIFIDFQFSAWNSPAIDLHYFFSTALQADIRLKKQPELVQFYYYKL 323
            |||.:|::...|:.|:......||:|..:...|.:||.......|.|..|.::..|:::.|:...
 Worm   271 DLWQSNMLHCLDEFGNLKLKAIIDWQGVSTLPPGLDLSRLLMGCLSAHERRERGLEMLKLYHETF 335

  Fly   324 NAALKKVQYSGNVPSLFVFHQQFRNRSFYAAFASLIFEPTMT 365
            |..|.|        .||.|.:...:.:.|....:::..|.::
 Worm   336 NQVLGK--------ELFSFQELQDSYNLYYPMMAMLLLPIVS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11891NP_001027211.3 None
E02C12.10NP_505430.3 DUF1679 3..408 CDD:369592 54/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.