DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33912 and CG14455

DIOPT Version :9

Sequence 1:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:134 Identity:32/134 - (23%)
Similarity:50/134 - (37%) Gaps:39/134 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FALIEYCYLKSVNRSY-------------KYVSIKVNL--------LKLPIS--------KVKIR 75
            |.|:....|....||:             |::.:||:|        |.:.|.        ::.:.
  Fly    14 FILVALMPLTGAWRSFKVILTSIDFEANDKFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQLVVD 78

  Fly    76 FGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFFIIHDIVLDKMSYHSVNNKLTKILPFPEG 140
            |||......|.. |.|.||:.||.:|..||:|     ::..|..|.:.:    ..|.|..|...|
  Fly    79 FGLETDKGNYST-LINRTLNFCKLMKQRNSDP-----LVRAIYEDLLKH----GTLFKECPIRSG 133

  Fly   141 HYMI 144
            .|.:
  Fly   134 TYSL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 21/69 (30%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.