DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33912 and CG33632

DIOPT Version :9

Sequence 1:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:180 Identity:113/180 - (62%)
Similarity:140/180 - (77%) Gaps:15/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKLILFISFLMYSTCYFTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLL 65
            |||||.|.::|.:....|.|||||||||.|||||:|||||:|.|||||:||||||||||:||.||
  Fly     1 MAIKLKLCVAFQLICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLL 65

  Fly    66 KLPISKVKIRFGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFF---------------IIH 115
            |:|::|:|::||||||..||||||||.|||.|:||||.|.||:||:|               ..|
  Fly    66 KIPVTKIKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNH 130

  Fly   116 DIVLDKMSYHSVNNKLTKILPFPEGHYMIEIHWIAYEINRAITKLYWTLT 165
            |:|||:|||||:|.|||:|||||||:|.:|:|||||:|:||||..|:..:
  Fly   131 DLVLDEMSYHSINYKLTEILPFPEGNYKLEVHWIAYDIDRAITTFYFAFS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 50/84 (60%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 50/84 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472006
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.