DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33912 and CG33463

DIOPT Version :9

Sequence 1:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:179 Identity:75/179 - (41%)
Similarity:119/179 - (66%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKLILFISFLMYSTCYFTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLL 65
            :::.|.|:::..:.|     :..:::||.|:.||::||:|:..||||||||||:|||:|:|:.||
  Fly     5 LSLLLTLWLAMQLAS-----KTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLL 64

  Fly    66 KLPISKVKIRFGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFF---------------IIH 115
            :||::..|:...|::|..||||||||.|:|.||.:|:|..:|||.:|               ..|
  Fly    65 QLPVTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNH 129

  Fly   116 DIVLDKMSYHSVNNKLTKILPFPEGHYMIEIHWIAYEINRAITKLYWTL 164
            ||:|||::..||.:::|.|||||||.||::::|....|.|.|.|::.:|
  Fly   130 DIILDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 37/84 (44%)
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 37/84 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472011
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.