DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33912 and CG33467

DIOPT Version :9

Sequence 1:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:150 Identity:35/150 - (23%)
Similarity:68/150 - (45%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LMYSTCY---FTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISKVK 73
            ::.|.|:   .|:...:.:|..|:|:........:. |.:|.:|.:...|::...|: .|:....
  Fly     7 VLLSICFIGHMTDSQLVYKFTKVECQGNQARVKNVS-CNVKPINWNTALVNLDCYLI-YPLINPT 69

  Fly    74 IRFGLY-KRFTG-YKPFLYNATLDACKFLKSPNSNPVA-LFFIIHDIVLDKMSYHSVNNKLTK-- 133
            ||..:: |.::. |||||.:||...|..::..|..|.| :.:.:.....:..|.| ::.:|:.  
  Fly    70 IRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVKSCH-ISGQLSARN 133

  Fly   134 -------ILPFPEGHYMIEI 146
                   :.|||.|.|.|.:
  Fly   134 GYLNSSYVPPFPHGQYQISV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 22/81 (27%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.