DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33912 and CG33476

DIOPT Version :9

Sequence 1:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:181 Identity:34/181 - (18%)
Similarity:56/181 - (30%) Gaps:69/181 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FISFLMYSTC------YFTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLK 66
            ||...:.::|      ||.:...:|:....:...|.|.|.                       :.
  Fly    19 FIMESLATSCDHNFVEYFHKAPDMVDIYTFRVVKLAKAFT-----------------------ID 60

  Fly    67 LPISKVKIRFGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFFIIHDIVLDKMSYHSV---- 127
            ..:..||.:..:||          ....|.|:||.:|..|.|  |..::..::...|:.|.    
  Fly    61 FAVRVVKTKRVMYK----------VDNFDGCQFLMNPLMNRV--FGTVYKRLVVNGSFFSCPIKP 113

  Fly   128 ------NNKLTKILPF--PEGHYMI---------------EIHWIAYEINR 155
                  |.....:||.  |.|.|.|               |:.|: |.:.|
  Fly   114 GVYYIRNEGSVAMLPVFQPPGRYQITMRVRMRESRDPFVMEMLWV-YSVVR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 18/81 (22%)
CG33476NP_995798.2 DUF1091 57..138 CDD:284008 21/115 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.