DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33773 and CG13589

DIOPT Version :9

Sequence 1:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:193 Identity:52/193 - (26%)
Similarity:89/193 - (46%) Gaps:40/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKRINLILAILIFYSIIKTNSRFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLN- 64
            |:.:|...::::::.:.:.......:.||..|.:::........|.||:.:|:      |..|| 
  Fly     1 MNRRRAAFVVSVILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRT------KTSLNI 59

  Fly    65 ----QIPLPRMKVNFIMWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSC 125
                ..|...:.::..|.|:.|||:|||::.|.|||:|:.. ::.|..|.:::.....|.:||:|
  Fly    60 NATFIEPAKNIYLHMKMMKKANGYKPFLFDYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTC 123

  Fly   126 PY-----TSDLIVERLPIGFMNLRVTEILPFPEGNYL------FEFHFSRRKSIFASTQVYFT 177
            ||     .||.....:|:           |.|.|:||      |:|     |..|| |.||||
  Fly   124 PYEGLQMLSDFHHIDVPV-----------PLPSGDYLLLLDWIFDF-----KPQFA-TNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 29/95 (31%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 35/105 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472443
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.